PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.201140.1
Common NameCsa_4G043960, LOC101216097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 264aa    MW: 28663.7 Da    PI: 6.5901
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.201140.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702101.21.9e-31100161667
          DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa 67 
                     +sCqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpa+krr+r+ +   ++sk+ +++
  Cucsa.201140.1 100 TSCQDCGNQAKKDCVHMRCRTCCKSRGFECETHVKSTWVPASKRRDRHLRSDGLNSKRPKDT 161
                     69*********************************************988888777766654 PP

2DUF70285.21.6e-2616422494154
          DUF702  94 aeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     + +++ l++ ++P+ev ++avfrcvr++s+d+ ++++aYqtav+igGh+fkGiLyd+G+e+
  Cucsa.201140.1 164 HPTSSGLDMGNFPTEVTTPAVFRCVRMTSLDETDDQYAYQTAVNIGGHIFKGILYDHGPEQ 224
                     55667788999************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.8E-53100223IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.3E-28101143IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.4E-25175222IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MAGFFPLDGG GSGGRVPNYH FPTPTTGGEI IHPTTEGLFW YKNYERLETW EGEEQQQQQQ  60
PAQEQGGEGF VYSGDESPAR SSLVMVRSGR GGGGGGGPVT SCQDCGNQAK KDCVHMRCRT  120
CCKSRGFECE THVKSTWVPA SKRRDRHLRS DGLNSKRPKD THYHPTSSGL DMGNFPTEVT  180
TPAVFRCVRM TSLDETDDQY AYQTAVNIGG HIFKGILYDH GPEQPPPPPS SSSAALLDPT  240
PPYPTPLSTY ITAGTQFFLP PSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6820150.0LN682015.1 Cucumis melo genomic scaffold, unanchored_scaffold00177.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004146546.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9LQZ52e-52SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A0A0KUG20.0A0A0A0KUG2_CUCSA; Uncharacterized protein
STRINGVIT_18s0001g13420.t016e-62(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2470533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.23e-51SHI-related sequence 7
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]